PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008726m
Common NameCICLE_v10008720mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family bZIP
Protein Properties Length: 364aa    MW: 40891.8 Da    PI: 7.0111
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008726mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.6e-11228273550
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Ciclev10008726m 228 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 273
                      8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.1E-13224288IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703226278IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.14E-12228282No hitNo description
PfamPF001709.7E-10228272IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-14228279No hitNo description
CDDcd147037.23E-24229279No hitNo description
PROSITE patternPS000360231246IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MAQLPPKIPN MSHNWSSFPY QRMSFISSNN NNNNDNNNNN IANAATTMTL NNNNNIHHNQ  60
PHWVDEFLDF SSVRRGAHRR SISDSVAFLD PPSSLVVVEE CRNSNNSNNN NNNSTINNIM  120
SSSDANYCFD RLDDEQLMSM FSDDISVSVP PTASSSNPST PSDQNSNNDE KVTAPSDQQQ  180
QQKQQQQQPK NEPGEVESSC KNNEPSSSQT TTHQTPPASN GDTIIDPKRV KRILANRQSA  240
QRSRVRKLQY ISELERSVTT LQTEVSALSP RVAFLDHQRL ILNVDNSALK QRIAALAQDK  300
IFKDAHQEAL KKEIERLRQV YHQQNIKKMK NNNNSNNNAT PPPQQPPSQP MNTDTIVCMD  360
KDQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.23440.0flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451750.10.0hypothetical protein CICLE_v10008720mg
RefseqXP_006494850.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-106BZP61_ARATH; Basic leucine zipper 61
TrEMBLV4UL580.0V4UL58_9R
STRINGVIT_19s0014g01780.t011e-121(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-83bZIP family protein